Rabbit monoclonal anti-SARS-CoV-2 spike RBD neutralizing antibody
This rabbit monoclonal antibody was raised against the RBD domain of the SARS-CoV-2 S1 protein (Arg319 to Phe541, sequence below). The antibody was validated through binding assays (ELISA) and neutralization assays for its ability to neutralize SARS-CoV-2 pseudoviruses such as Ha-CoV-2 and Ha-CoV-2 variants (e.g. delta and omicron). The antibody was expressed in mammalian cells and purified as a recombinant protein. Antibody 27VBI has an extremely high affinity to RBD, and is be able to detect as low as 0.5 pg/ml RBD protein in human serum. For more information, please contact us by email: info@virongy.com
RBD antigen protein sequence:
rvqptesivrfpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddft
gcviawnsnnldskvggnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvlsfellhapatvcgpkkstnlvknkcvnf
Application
- ELISA – Clone 27VBI has been validated for ELISA assay to quantify of SARS-CoV-2 spike protein.
- Neutralizing antibody assay – Clone 27VBI has been validated in neutralizing antibody assays for neutralizing SARS-CoV-2 pseudoviruses such as Ha-CoV-2 and Ha-CoV-2 variants.
- Western blot – not tested
- Fluorescent imaging – not tested
Left, 27VBI was used in an ELISA assay to quantify SARS-CoV-2 spike RBD protein. Right, RBD protein was mixed with human serum (0.5 pg/ml) and then detected by 27VBI in an ELISA assay.
Left, 27VBI was used in Ha-CoV-2 pseudovirus neutralizing antibody assay. Right, 27VBI was used in Ha-CoV-2 (Omicron) variant pseudovirus neutralizing antibody assay.
Rabbit monoclonal anti-SARS-CoV-2 spike RBD antibody 27VBI
Catalog No. |
Products | Price1 |
27VBI-01 | 20 μg of Rabbit monoclonal antibody 27VBI, unlabeled. | $150.00 |
27VBI-02 | 110 μg of Rabbit monoclonal antibody 27VBI, unlabeled. | $400.00 |
27VBI-03 | 515 μg of Rabbit monoclonal antibody 27VBI, unlabeled. | $1,800.00 |
27VBI-04 | 1010 μg of Rabbit monoclonal antibody 27VBI, unlabeled. | $3,200.00 |
1Academic and government price, others inquire. | ||
Technical Support Email: info@virongy.com |
|
Email us for Certificate of Analysis