…construct of their choice, and we will assemble particles within a week. Please contact us by email: info@virongy.com To enhance your pseudovirus entry, ask about receiving a free sample of…
…GFP expression vector with Virongy Transfectin. GFP expression was visualized with fluorescent microscopy at 48 hours post transfection. Questions on kit volumes and pricing? Please email info@virongy.com …
…quantification of neutralizing antibodies. Customers can provide us with the reporter construct of your choice, and we will assemble particles within a week. Please contact us by email: info@virongy.com We…
…All non-tagged spike protein expression vectors have been functionally validated using pseudotyped viral particles. Example plasmid map: Don’t See the specific protein of interest? Email: info@virongy.com to ask us about…
…in human serum. For more information, please contact us by email: info@virongy.com RBD antigen protein sequence: rvqptesivrfpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddft gcviawnsnnldskvggnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvlsfellhapatvcgpkkstnlvknkcvnf Application ELISA – Clone 27VBI has been validated for ELISA assay to…
Low-Speed Viral Concentration Kit Virongy’s Low-Speed Viral Concentration Kit is designed to enhance virus titer, maximize transduction efficiency and increase particle purity. Our propriety Viral Concentration and Resuspension Buffers come…
…assemble HA-NiV pseudoviruses at any scale. If you have any additional questions please contact us by email: info@virongy.com To enhance your pseudovirus entry, ask about receiving a free sample…
…by email: info@virongy.com To enhance your pseudovirus entry, ask about receiving a free sample of our propriety Infectin that can significantly promote productive viral infection in a variety of host…
…All non-tagged glycoprotein expression vectors have been functionally validated using pseudotyped viral particles. Example plasmid map: Don’t See the specific protein of interest? Email: info@virongy.com to ask us about a…