…primarily in brain tissue including neurons, and astroglial cells. Example plasmid map: Don’t See the specific protein of interest? Email: info@virongy.com to ask us about a custom expression vector order….
…have been functionally validated using pseudotyped viral particles. Example plasmid map: Don’t See the specific protein of interest? Email: info@virongy.com to ask us about a custom expression vector order….
…All non-tagged glycoprotein expression vectors have been functionally validated using pseudotyped viral particles. Example plasmid map: Don’t See the specific protein of interest? Email: info@virongy.com to ask us about a…
…All non-tagged spike protein expression vectors have been functionally validated using pseudotyped viral particles. Example plasmid map: Don’t See the specific protein of interest? Email: info@virongy.com to ask us about…
Contact Us Lorem ipsum dolor ipset alun creaulitarus ipsul lorem dolor Send A Message Name * First Last Email * Comment or Message Submit Contact Mobile: 703.257.5500 E-mail: info@virongy.com Address…
…in human serum. For more information, please contact us by email: info@virongy.com RBD antigen protein sequence: rvqptesivrfpnitnlcpfgevfnatrfasvyawnrkrisncvadysvlynsasfstfkcygvsptklndlcftnvyadsfvirgdevrqiapgqtgkiadynyklpddft gcviawnsnnldskvggnynylyrlfrksnlkpferdisteiyqagstpcngvegfncyfplqsygfqptngvgyqpyrvvvlsfellhapatvcgpkkstnlvknkcvnf Application ELISA – Clone 27VBI has been validated for ELISA assay to…